PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 455aa    MW: 49784.7 Da    PI: 4.6769
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082025.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.92.3e-171763349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    ie++   + tfskRr g+ KKA+ELS+LC++++ +iifs+t++ y +
  XP_011082025.1 17 IESQDDLYATFSKRRLGLYKKASELSTLCGVDIGIIIFSPTNNPYSF 63
                    888999999********************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554557.46E-24779IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.236767IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-23766IPR002100Transcription factor, MADS-box
CDDcd002654.50E-31878No hitNo description
PRINTSPR004047.5E-13929IPR002100Transcription factor, MADS-box
PfamPF003198.9E-211763IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-132944IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-134465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MAGRQTRGRQ KIPMRLIESQ DDLYATFSKR RLGLYKKASE LSTLCGVDIG IIIFSPTNNP  60
YSFFHPSMES VIERYRNPDQ PPNDLARIVE GHTRTRIEQL NKRLDEILDM KEQIKEREKY  120
LDEVDKTRPR GWWEQPIESL NAQQVQEWKE WFGNFHAQVT SRIEELTNGG SGSLENAPIF  180
PDPPSSSTTA VPSMFPPNYV PPADTSSALG DGIAEVDQFS GQYYYAPPQG QDPFVVGSNQ  240
FYDPPQCQGP NSGTNQYLSL SEAPNPSGTG SSQYYGPPSI QNPSGAGPSL YYGPPSVQNP  300
SGPGPSQYYG LPLSQNPPAA GSNKYYEPPQ AQDPSGTGPN QYYGPPLAPT PSVFGLSQFY  360
GLQQGQDPSN IGPNQFNVPL STKNPSGVGP NQFYGPPPGQ DPFGIGPSQF YRPPLGQDSS  420
GIRPRRFYNA QQGRDPSATG GTKEAGTSNQ EDSDL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082025.10.0PREDICTED: proline-rich extensin-like protein EPR1 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-34AGAMOUS-like 61